McDonnell Genome Institute

Washington University

Transcript

lnc-TOMM20-7:1

Chromosome

chr1

Gene Name

lnc-TOMM20-7

Start

235006743

CPC Label

noncoding

End

235011962

Cancer

OV

Strand

-

Peptide

LSHVGPPTFPPPMDLLSK

Modified Peptide

n[145]LSHVGPPTFPPPM[147]DLLSK

Peptide Length

18

ORF Length

73

Open Reading Frame (ORF)

LSHVGPPTFPPPMDLLSKGSGAQALIAWEIRRDVWVGGLAWRVDILLQMALPSRKAIVIPRLPPGRVQPPEPS

Conservation Score

0.037

PhyloCSF Frame 1

-2.976

No. of Spectra

2

CPC Coding Probability

0.0893099

PhyloCSF Frame 2 

-5.038

CNTI Index

noncoding

Max Probability

0.311

PhyloCSF Frame 3

-5.389

CNTI Score

-0.335594735