McDonnell Genome Institute

Washington University

Transcript

lnc-TOMM20-2:31

Chromosome

chr1

Gene Name

lnc-TOMM20-2

Start

234952010

CPC Label

noncoding

End

234962143

Cancer

OV

Strand

-

Peptide

LLVVRPAGDPFPR

Modified Peptide

n[145]LLVVRPAGDPFPR

Peptide Length

13

ORF Length

60

Open Reading Frame (ORF)

LLVVRPAGDPFPRNQRLRDKQLAPARGALHTAFCLIFLFEACPLHERWASSHVPEFLGVR

Conservation Score

0.573

PhyloCSF Frame 1

-2.029

No. of Spectra

39

CPC Coding Probability

0.249818

PhyloCSF Frame 2 

-3.219

CNTI Index

noncoding

Max Probability

0.99

PhyloCSF Frame 3

-4.298

CNTI Score

-0.299349877