McDonnell Genome Institute

Washington University

Transcript

lnc-TOMM20-2:14

Chromosome

chr1

Gene Name

lnc-TOMM20-2

Start

234959658

CPC Label

noncoding

End

234963314

Cancer

PRAD

Strand

-

Peptide

GILPMLLR

Modified Peptide

GILPM[147]LLR

Peptide Length

8

ORF Length

67

Open Reading Frame (ORF)

LSFLKKLVTEKGILPMLLRSLSRLSSFPATPLKSLLKNPKLKKKKIYSCRFFLCGSMFHSSAFRLDL

Conservation Score

1

PhyloCSF Frame 1

-5.816

No. of Spectra

1

CPC Coding Probability

0.0285122

PhyloCSF Frame 2 

-2.874

CNTI Index

noncoding

Max Probability

0.8873

PhyloCSF Frame 3

-3.657

CNTI Score

-0.442349865