McDonnell Genome Institute

Washington University

Transcript

lnc-TOMM20-1:5

Chromosome

chr1

Gene Name

lnc-TOMM20-1

Start

234973904

CPC Label

noncoding

End

234981015

Cancer

OV

Strand

-

Peptide

NSDLDLVTK

Modified Peptide

n[145]NSDLDLVTK

Peptide Length

9

ORF Length

33

Open Reading Frame (ORF)

MTVSWACPLLPLLDCRRNSDLDLVTKTPIWKAL

Conservation Score

1

PhyloCSF Frame 1

-4.313

No. of Spectra

1

CPC Coding Probability

0.105374

PhyloCSF Frame 2 

-4.13

CNTI Index

noncoding

Max Probability

0.9927

PhyloCSF Frame 3

-4.725

CNTI Score

-0.349302195