McDonnell Genome Institute

Washington University

Transcript

lnc-TOM1L2-8:1

Chromosome

chr17

Gene Name

lnc-TOM1L2-8

Start

18002921

CPC Label

noncoding

End

18006329

Cancer

PRAD

Strand

-

Peptide

QILALVPR

Modified Peptide

Peptide Length

8

ORF Length

63

Open Reading Frame (ORF)

LSRAGRFQQRRAHEGYSSPMDVQLHRQILALVPRAQPYLQLLHQLHLQRHERIEQLTDVSTAF

Conservation Score

1

PhyloCSF Frame 1

8.074

No. of Spectra

3

CPC Coding Probability

0.0813256

PhyloCSF Frame 2 

-3.113

CNTI Index

noncoding

Max Probability

0.9951

PhyloCSF Frame 3

-2.645

CNTI Score

-0.320176993