McDonnell Genome Institute

Washington University

Transcript

lnc-TOGARAM1-1:1

Chromosome

chr14

Gene Name

lnc-TOGARAM1-1

Start

45078086

CPC Label

noncoding

End

45078578

Cancer

LUAD

Strand

+

Peptide

LDLNPWAQGILPPQPTK

Modified Peptide

n[230]LDLNPWAQGILPPQPTK

Peptide Length

17

ORF Length

34

Open Reading Frame (ORF)

MLLRLDLNPWAQGILPPQPTKTAEITGMIHLARP

Conservation Score

0.553

PhyloCSF Frame 1

0

No. of Spectra

3

CPC Coding Probability

0.108221

PhyloCSF Frame 2 

0

CNTI Index

noncoding

Max Probability

0.9956

PhyloCSF Frame 3

0

CNTI Score

-0.448613904