McDonnell Genome Institute

Washington University

Transcript

lnc-TOB2-3:1

Chromosome

chr22

Gene Name

lnc-TOB2-3

Start

41366052

CPC Label

noncoding

End

41381281

Cancer

OV

Strand

-

Peptide

HAVETIPGWDLR

Modified Peptide

n[145]HAVETIPGWDLR

Peptide Length

12

ORF Length

90

Open Reading Frame (ORF)

MEVPWRPRHAVETIPGWDLRLQEKRRMTGKDSTSGSRAQDTLCWQMQGCGRTSCLHLCASEPQGLVACFDAVFMPCTRTLQGTPVYIWHA

Conservation Score

0.887

PhyloCSF Frame 1

-2.716

No. of Spectra

13

CPC Coding Probability

0.273283

PhyloCSF Frame 2 

-2.641

CNTI Index

noncoding

Max Probability

0.8973

PhyloCSF Frame 3

-1.243

CNTI Score

-0.272551442