McDonnell Genome Institute

Washington University

Transcript

lnc-TNPO1-2:1

Chromosome

chr5

Gene Name

lnc-TNPO1-2

Start

72599735

CPC Label

noncoding

End

72600773

Cancer

HCC

Strand

+

Peptide

LFLSWRSQPGTTTESLSSEGQR

Modified Peptide

n[230]LFLSWRSQPGTTTESLSSEGQR

Peptide Length

22

ORF Length

53

Open Reading Frame (ORF)

LQTWVACLSLGRLFLSWRSQPGTTTESLSSEGQRRRPPTGLLSPGARSRVRAT

Conservation Score

0.091

PhyloCSF Frame 1

-5.16

No. of Spectra

3

CPC Coding Probability

0.098319

PhyloCSF Frame 2 

-4.007

CNTI Index

noncoding

Max Probability

0.0967

PhyloCSF Frame 3

-4.139

CNTI Score

-0.397612038