McDonnell Genome Institute

Washington University

Transcript

lnc-TNP1-5:1

Chromosome

chr2

Gene Name

lnc-TNP1-5

Start

217062323

CPC Label

noncoding

End

217066977

Cancer

OSCC

Strand

-

Peptide

LKEAPFAK

Modified Peptide

n[145]LKEAPFAK

Peptide Length

8

ORF Length

54

Open Reading Frame (ORF)

LQKLKEAPFAKFFFVLFPTILLIRSTDSVRLRLVFRWHWIDRLILIGVGVSIFS

Conservation Score

0.042

PhyloCSF Frame 1

-5.233

No. of Spectra

6

CPC Coding Probability

0.0674608

PhyloCSF Frame 2 

0

CNTI Index

noncoding

Max Probability

0.6024

PhyloCSF Frame 3

-3.382

CNTI Score

-0.374185724