McDonnell Genome Institute

Washington University

Transcript

lnc-TNNT3-4:1

Chromosome

chr11

Gene Name

lnc-TNNT3-4

Start

1973758

CPC Label

coding

End

1978444

Cancer

OSCC

Strand

+

Peptide

LEGEAPLGCQAGR

Modified Peptide

n[145]LEGEAPLGCQAGR

Peptide Length

13

ORF Length

196

Open Reading Frame (ORF)

LGWARFSSPLWLKPPGLQCWLEEGVGLPRRGDWQFFPPLFPNFQTGPLKNNEVQVVPLEPGSSLAVGLSFPCRSHLPPGAANDSQRLEGEAPLGCQAGRRAGAGQAKGATLLPRPGHPITAPHPLWPSVQPGPCCRCFPWDCRENNQDFCLLGRAGLPPHLIYWQGGWAPSGSFSLGRGRRSEVDGGDGCAAVRMD

Conservation Score

0.996

PhyloCSF Frame 1

0

No. of Spectra

1

CPC Coding Probability

0.818379

PhyloCSF Frame 2 

0

CNTI Index

noncoding

Max Probability

0.8366

PhyloCSF Frame 3

0

CNTI Score

-0.260619771