McDonnell Genome Institute

Washington University

Transcript

lnc-TNN-3:1

Chromosome

chr1

Gene Name

lnc-TNN-3

Start

175556987

CPC Label

noncoding

End

175563869

Cancer

BRCA-HER2-enriched

Strand

+

Peptide

DLAGYVK

Modified Peptide

n[145]DLAGYVK

Peptide Length

7

ORF Length

44

Open Reading Frame (ORF)

LSDKGQRDLAGYVKLQVLAAVMSSPFCFFSARLQTPEVKHLMIT

Conservation Score

1

PhyloCSF Frame 1

-4.368

No. of Spectra

14

CPC Coding Probability

0.0952292

PhyloCSF Frame 2 

-4.353

CNTI Index

noncoding

Max Probability

0.9969

PhyloCSF Frame 3

0.957

CNTI Score

-0.375236202