McDonnell Genome Institute

Washington University

Transcript

lnc-TNK2-2:9

Chromosome

chr3

Gene Name

lnc-TNK2-2

Start

195939402

CPC Label

noncoding

End

195945710

Cancer

OV

Strand

-

Peptide

LMFQFEGHAAGDPAGSSCSSLQAVHLETR

Modified Peptide

n[145]LM[147]FQFEGHAAGDPAGSSCSSLQAVHLETR

Peptide Length

29

ORF Length

36

Open Reading Frame (ORF)

LMFQFEGHAAGDPAGSSCSSLQAVHLETRRGADVPV

Conservation Score

0.014

PhyloCSF Frame 1

0

No. of Spectra

8

CPC Coding Probability

0.0754043

PhyloCSF Frame 2 

0

CNTI Index

noncoding

Max Probability

0.7525

PhyloCSF Frame 3

0

CNTI Score

-0.372119287