McDonnell Genome Institute

Washington University

Transcript

lnc-TNK2-2:1

Chromosome

chr3

Gene Name

lnc-TNK2-2

Start

195949187

CPC Label

noncoding

End

195952695

Cancer

EOGC

Strand

-

Peptide

EVQDMATR

Modified Peptide

n[145]EVQDMATR

Peptide Length

8

ORF Length

59

Open Reading Frame (ORF)

LCFLDFSLFIILKSSFFLFASQFVYTREVQDMATRKRCQENRNPVGYNLANLSLKLPKC

Conservation Score

0.051

PhyloCSF Frame 1

-3.864

No. of Spectra

2

CPC Coding Probability

0.0363852

PhyloCSF Frame 2 

-5.528

CNTI Index

noncoding

Max Probability

1

PhyloCSF Frame 3

-4.974

CNTI Score

-0.337138062