McDonnell Genome Institute

Washington University

Transcript

lnc-TNFSF9-3:1

Chromosome

chr19

Gene Name

lnc-TNFSF9-3

Start

6593328

CPC Label

noncoding

End

6594055

Cancer

EOGC

Strand

+

Peptide

GIDGVSPK

Modified Peptide

n[145]GIDGVSPK

Peptide Length

8

ORF Length

99

Open Reading Frame (ORF)

LKTKRLRKKFAQKMLRKARRKLIYEKLKHYHKEYRQRYRTEIRMEKMSRKAGNFYEPAESRLAFVIRIRGIDGVSPKVRNVLQLLCLCQIFNGTFVKAN

Conservation Score

1

PhyloCSF Frame 1

0

No. of Spectra

644

CPC Coding Probability

0.281794

PhyloCSF Frame 2 

0

CNTI Index

coding

Max Probability

1

PhyloCSF Frame 3

0

CNTI Score

0.674351323