McDonnell Genome Institute

Washington University

Transcript

lnc-TNFSF9-1:1

Chromosome

chr19

Gene Name

lnc-TNFSF9-1

Start

6566080

CPC Label

noncoding

End

6569214

Cancer

OSCC

Strand

+

Peptide

GFPGLMR

Modified Peptide

n[145]GFPGLMR

Peptide Length

7

ORF Length

75

Open Reading Frame (ORF)

LALMLPKGFPGLMRTCPPPFPSGLEYLVGYKHFDSKSLGHGVPPRDMLGLGRQTHHPSNNMGQNRSLAIDVASGI

Conservation Score

0.42

PhyloCSF Frame 1

0

No. of Spectra

1

CPC Coding Probability

0.0651383

PhyloCSF Frame 2 

0

CNTI Index

noncoding

Max Probability

0.9565

PhyloCSF Frame 3

0

CNTI Score

-0.413749715