McDonnell Genome Institute

Washington University

Transcript

lnc-TNFSF4-3:2

Chromosome

chr1

Gene Name

lnc-TNFSF4-3

Start

173209708

CPC Label

coding

End

173477140

Cancer

EOGC

Strand

-

Peptide

TGLTGAK

Modified Peptide

n[145]TGLTGAK

Peptide Length

7

ORF Length

82

Open Reading Frame (ORF)

LQRGRGDDYQMGEWCSQLIAKVWQKTWWTEGLGGGRTGLTGAKVWVESVILWPCSLFICSCCVALQAYSHAPSLIALLFTIA

Conservation Score

0.144

PhyloCSF Frame 1

-4.697

No. of Spectra

13

CPC Coding Probability

0.987053

PhyloCSF Frame 2 

-3.719

CNTI Index

coding

Max Probability

0.9807

PhyloCSF Frame 3

-4.022

CNTI Score

0.641468071