McDonnell Genome Institute

Washington University

Transcript

lnc-TNFSF18-1:1

Chromosome

chr1

Gene Name

lnc-TNFSF18-1

Start

172932275

CPC Label

noncoding

End

172933730

Cancer

OV

Strand

-

Peptide

LVMNTNSNPEK

Modified Peptide

n[145]LVM[147]NTNSNPEK

Peptide Length

11

ORF Length

56

Open Reading Frame (ORF)

LPASASQSAGITGVSHHARPKSAISIPTRLVMNTNSNPEKFTFVPSTQPTVCHTGN

Conservation Score

0.442

PhyloCSF Frame 1

0

No. of Spectra

1

CPC Coding Probability

0.0195095

PhyloCSF Frame 2 

0

CNTI Index

noncoding

Max Probability

0.8807

PhyloCSF Frame 3

0

CNTI Score

-0.366318096