McDonnell Genome Institute

Washington University

Transcript

lnc-TNFRSF19-9:1

Chromosome

chr13

Gene Name

lnc-TNFRSF19-9

Start

23715192

CPC Label

noncoding

End

23726409

Cancer

OV

Strand

+

Peptide

VSFYMISPK

Modified Peptide

n[145]VSFYMISPK

Peptide Length

9

ORF Length

37

Open Reading Frame (ORF)

MKTHHTHLPHYCMYSRVSFYMISPKCSYNGDLSLTLK

Conservation Score

0.036

PhyloCSF Frame 1

-5.075

No. of Spectra

15

CPC Coding Probability

0.10378

PhyloCSF Frame 2 

-4.31

CNTI Index

noncoding

Max Probability

0.7045

PhyloCSF Frame 3

-4.473

CNTI Score

-0.323164302