McDonnell Genome Institute

Washington University

Transcript

lnc-TNFRSF14-66:4

Chromosome

chr1

Gene Name

lnc-TNFRSF14-66

Start

2546464

CPC Label

noncoding

End

2547460

Cancer

OV

Strand

+

Peptide

FEAAGGGDAPGGEGQVCGEGLGSASPAGQR

Modified Peptide

n[145]FEAAGGGDAPGGEGQVCGEGLGSASPAGQR

Peptide Length

30

ORF Length

142

Open Reading Frame (ORF)

MKSNGPERPRPLPRSSAQQPRPQGTRWTPWWPLCQAPHLPANQRGFPFPSCLVPSARAGRGLSSPSHGGSGQSTYWRWGSGERVLLGRRFEAAGGGDAPGGEGQVCGEGLGSASPAGQRFPSQAPQLDPGSVQPGKGLHGLC

Conservation Score

0.116

PhyloCSF Frame 1

0

No. of Spectra

2

CPC Coding Probability

0.254707

PhyloCSF Frame 2 

0

CNTI Index

noncoding

Max Probability

0.4319

PhyloCSF Frame 3

0

CNTI Score

-0.279012104