McDonnell Genome Institute

Washington University

Transcript

lnc-TNFRSF14-2:1

Chromosome

chr1

Gene Name

lnc-TNFRSF14-2

Start

2566409

CPC Label

noncoding

End

2577372

Cancer

OV

Strand

+

Peptide

SSAMLLTMPVCYLTMK

Modified Peptide

n[145]SSAM[147]LLTM[147]PVCYLTMK

Peptide Length

16

ORF Length

77

Open Reading Frame (ORF)

MWKVDFQHGWDPRGLWTPGPWDSQVGDRSSAMLLTMPVCYLTMKSHLGQAWWLTPVIPALWEVEACGSSEIRSLRPS

Conservation Score

0.272

PhyloCSF Frame 1

0

No. of Spectra

7

CPC Coding Probability

0.135465

PhyloCSF Frame 2 

0

CNTI Index

noncoding

Max Probability

0.9599

PhyloCSF Frame 3

0

CNTI Score

-0.277952513