McDonnell Genome Institute

Washington University

Transcript

lnc-TNFRSF14-1:1

Chromosome

chr1

Gene Name

lnc-TNFRSF14-1

Start

2550975

CPC Label

noncoding

End

2555402

Cancer

EOGC

Strand

+

Peptide

AFVAGGK

Modified Peptide

n[145]AFVAGGK

Peptide Length

7

ORF Length

43

Open Reading Frame (ORF)

LKTVHPEFQSRAFVAGGKLLAVLLHGGWNGRDQLPSEGHFGWF

Conservation Score

0.188

PhyloCSF Frame 1

-4.527

No. of Spectra

172

CPC Coding Probability

0.121498

PhyloCSF Frame 2 

-3.308

CNTI Index

noncoding

Max Probability

0.9984

PhyloCSF Frame 3

-5.049

CNTI Score

-0.309167212