McDonnell Genome Institute

Washington University

Transcript

lnc-TNFRSF13B-9:1

Chromosome

chr17

Gene Name

lnc-TNFRSF13B-9

Start

16847634

CPC Label

coding

End

16852776

Cancer

OSCC

Strand

-

Peptide

LLEVEDAR

Modified Peptide

n[145]LLEVEDAR

Peptide Length

8

ORF Length

71

Open Reading Frame (ORF)

LEGSLVETEVCYRTQLAQLQGLIRSMEQQLCELCCDAEHQDHEHQVLLDVKTRLEQEIATYSRLLEVEDAR

Conservation Score

1

PhyloCSF Frame 1

5.218

No. of Spectra

6

CPC Coding Probability

0.565608

PhyloCSF Frame 2 

-3.374

CNTI Index

noncoding

Max Probability

0.9985

PhyloCSF Frame 3

-2.026

CNTI Score

-0.264140233