McDonnell Genome Institute

Washington University

Transcript

lnc-TNFRSF13B-5:2

Chromosome

chr17

Gene Name

lnc-TNFRSF13B-5

Start

16922914

CPC Label

coding

End

16934839

Cancer

OV

Strand

-

Peptide

HHGSLHGITCDQGAPSR

Modified Peptide

n[145]HHGSLHGITCDQGAPSR

Peptide Length

17

ORF Length

138

Open Reading Frame (ORF)

LQCRQSDLWSPAQKCPECPGFTCQYATWRLQGPACCTPASPLLSTPSDDERLAVDSWAGTISQEDQRAACGQAAHTVEGAEISLHCRKPLPGHRLAGSTYRHHGSLHGITCDQGAPSRSVCPGCCFPSCHPLFDCLCQ

Conservation Score

0.343

PhyloCSF Frame 1

0

No. of Spectra

1

CPC Coding Probability

0.991744

PhyloCSF Frame 2 

0

CNTI Index

noncoding

Max Probability

0.5593

PhyloCSF Frame 3

0

CNTI Score

-0.274548457