McDonnell Genome Institute

Washington University

Transcript

lnc-TNFRSF13B-4:2

Chromosome

chr17

Gene Name

lnc-TNFRSF13B-4

Start

16819512

CPC Label

noncoding

End

16822128

Cancer

HCC

Strand

-

Peptide

LVSYLDK

Modified Peptide

n[230]LVSYLDK

Peptide Length

7

ORF Length

119

Open Reading Frame (ORF)

LVSYLDKVRALEEANADLEVKIHDWYQWQRPAKIKDYSPYFKTIEDLRNKILTATVDNANVLLQIDNARLAADDFRTKRVCSGGPEHPVSPKYETELNLRMSVGADINGMRQVLGCWTN

Conservation Score

1

PhyloCSF Frame 1

3.937

No. of Spectra

1

CPC Coding Probability

0.010038

PhyloCSF Frame 2 

0

CNTI Index

coding

Max Probability

0.9313

PhyloCSF Frame 3

12.244

CNTI Score

0.756280448