McDonnell Genome Institute

Washington University

Transcript

lnc-TNFRSF13B-2:1

Chromosome

chr17

Gene Name

lnc-TNFRSF13B-2

Start

17011913

CPC Label

noncoding

End

17014990

Cancer

CCRC

Strand

-

Peptide

SIFLCYK

Modified Peptide

n[272]SIFLCYK

Peptide Length

7

ORF Length

36

Open Reading Frame (ORF)

MSIFLCYKCPLKYVVSCDSLVFYPRFPRLLHLGGIQ

Conservation Score

0.029

PhyloCSF Frame 1

-5.349

No. of Spectra

23

CPC Coding Probability

0.0742123

PhyloCSF Frame 2 

-5.26

CNTI Index

noncoding

Max Probability

0.997

PhyloCSF Frame 3

-5.427

CNTI Score

-0.302744146