McDonnell Genome Institute

Washington University

Transcript

lnc-TNFAIP8L1-3:1

Chromosome

chr19

Gene Name

lnc-TNFAIP8L1-3

Start

4621193

CPC Label

noncoding

End

4622307

Cancer

OV

Strand

+

Peptide

IAIYELLLR

Modified Peptide

n[145]IAIYELLLR

Peptide Length

9

ORF Length

44

Open Reading Frame (ORF)

LMAEENRIAIYELLLRRESWWPRRMPTCLSTQSWQTGMCPTYTS

Conservation Score

1

PhyloCSF Frame 1

0

No. of Spectra

9

CPC Coding Probability

0.130559

PhyloCSF Frame 2 

0

CNTI Index

noncoding

Max Probability

0.9976

PhyloCSF Frame 3

0

CNTI Score

-0.369629961