McDonnell Genome Institute

Washington University

Transcript

lnc-TNFAIP3-5:5

Chromosome

chr6

Gene Name

lnc-TNFAIP3-5

Start

137418153

CPC Label

noncoding

End

137430295

Cancer

OV

Strand

+

Peptide

GAKPRCYLGLLLK

Modified Peptide

n[145]GAKPRCYLGLLLK

Peptide Length

13

ORF Length

37

Open Reading Frame (ORF)

LIEQSRGAKPRCYLGLLLKSEIISVFFKPLQFGGFLF

Conservation Score

0.129

PhyloCSF Frame 1

-3.534

No. of Spectra

15

CPC Coding Probability

0.0100785

PhyloCSF Frame 2 

-3.654

CNTI Index

noncoding

Max Probability

0.7495

PhyloCSF Frame 3

-6.479

CNTI Score

-0.451445182