McDonnell Genome Institute

Washington University

Transcript

lnc-TNFAIP3-1:5

Chromosome

chr6

Gene Name

lnc-TNFAIP3-1

Start

137822798

CPC Label

noncoding

End

137830948

Cancer

OV

Strand

+

Peptide

INQCTFKSLTAQDTPQINLVVSFQVDPGR

Modified Peptide

n[145]INQCTFKSLTAQDTPQINLVVSFQVDPGR

Peptide Length

29

ORF Length

75

Open Reading Frame (ORF)

LLPQQWFSTGLCIRINQCTFKSLTAQDTPQINLVVSFQVDPGRQEPHAAWLGTEHLCQSLSPHPQANRATLFPDD

Conservation Score

0.012

PhyloCSF Frame 1

-5.311

No. of Spectra

1

CPC Coding Probability

0.0436669

PhyloCSF Frame 2 

-4.036

CNTI Index

noncoding

Max Probability

0.9943

PhyloCSF Frame 3

-5.507

CNTI Score

-0.368008325