McDonnell Genome Institute

Washington University

Transcript

lnc-TNFAIP2-2:1

Chromosome

chr14

Gene Name

lnc-TNFAIP2-2

Start

103138742

CPC Label

noncoding

End

103140014

Cancer

LUAD

Strand

+

Peptide

EGAGVDPK

Modified Peptide

n[230]EGAGVDPK

Peptide Length

8

ORF Length

154

Open Reading Frame (ORF)

LTLPAGARSKQTSSLSAGAGTGRGCLRVKGRLKGTVAGGPVLRRCLEQTRAGRCGGGRRLRRPAGGNGEEFQVSGKERRQDWGKGILDRRLRRRKEGAGVDPKYFLSCLATLPWTLNPAEYDTSPETQQAQAAGLALKSCLNRRPWRPASVPPA

Conservation Score

0.34

PhyloCSF Frame 1

0

No. of Spectra

14

CPC Coding Probability

0.0107413

PhyloCSF Frame 2 

0

CNTI Index

noncoding

Max Probability

0.9951

PhyloCSF Frame 3

0

CNTI Score

-0.291591938