McDonnell Genome Institute

Washington University

Transcript

lnc-TNC-21:2

Chromosome

chr9

Gene Name

lnc-TNC-21

Start

115607824

CPC Label

noncoding

End

115744265

Cancer

OV

Strand

-

Peptide

ELGAELDLK

Modified Peptide

n[145]ELGAELDLK

Peptide Length

9

ORF Length

119

Open Reading Frame (ORF)

MSLNLLFPIHEFCNGEHWIQTNPDLISTLHPQIYNVPGVRMPIMEAYTVVGELSLGITQDHKTEAKREEAICPRSHRELGAELDLKCKHLNCYLVFSFIYIKLHIFSSKYTSCILCKTK

Conservation Score

0.993

PhyloCSF Frame 1

-3.695

No. of Spectra

1

CPC Coding Probability

0.350997

PhyloCSF Frame 2 

-4.671

CNTI Index

noncoding

Max Probability

0.9028

PhyloCSF Frame 3

-4.485

CNTI Score

-0.425704649