McDonnell Genome Institute

Washington University

Transcript

lnc-TMUB2-2:1

Chromosome

chr17

Gene Name

lnc-TMUB2-2

Start

44191797

CPC Label

noncoding

End

44193969

Cancer

EOGC

Strand

+

Peptide

SVQPVLGTNYPNVGWLLLGR

Modified Peptide

n[145]SVQPVLGTNYPNVGWLLLGR

Peptide Length

20

ORF Length

76

Open Reading Frame (ORF)

LFGFLKNNHNLWVKNQFATRHEPQSEPPQRESGVPDRALQPHLCCSLNPLGSLTRSVQPVLGTNYPNVGWLLLGRG

Conservation Score

1

PhyloCSF Frame 1

-1.582

No. of Spectra

3

CPC Coding Probability

0.0723675

PhyloCSF Frame 2 

-2.391

CNTI Index

noncoding

Max Probability

0.1434

PhyloCSF Frame 3

0.197

CNTI Score

-0.300641496