McDonnell Genome Institute

Washington University

Transcript

lnc-TMUB2-1:3

Chromosome

chr17

Gene Name

lnc-TMUB2-1

Start

44221627

CPC Label

noncoding

End

44223774

Cancer

EOGC

Strand

+

Peptide

GGGVVTGK

Modified Peptide

n[145]GGGVVTGK

Peptide Length

8

ORF Length

53

Open Reading Frame (ORF)

LLFAFATLKQKGGGVVTGKKKARKKLLDLQHIGKPGEHPALSDLHAPQGPSGF

Conservation Score

1

PhyloCSF Frame 1

-0.262

No. of Spectra

16

CPC Coding Probability

0.0256577

PhyloCSF Frame 2 

-1.62

CNTI Index

noncoding

Max Probability

0.9984

PhyloCSF Frame 3

-2.368

CNTI Score

-0.281589662