McDonnell Genome Institute

Washington University

Transcript

lnc-TMUB2-1:1

Chromosome

chr17

Gene Name

lnc-TMUB2-1

Start

44221914

CPC Label

noncoding

End

44223710

Cancer

OV

Strand

+

Peptide

LLSQDFHIPLLSGFTNR

Modified Peptide

n[145]LLSQDFHIPLLSGFTNR

Peptide Length

17

ORF Length

139

Open Reading Frame (ORF)

LSLPPLFRGKVIRTGRREPEDHLKEACFQRAQPPATAPGAAPLLLALRLPVSHTDALLPASRPAGSPSPFRLSPGTQPSPSLGLPRCCCNSSCLLGEMRLLSQDFHIPLLSGFTNREEALSRSGVSCFFFFFFPEGTGM

Conservation Score

1

PhyloCSF Frame 1

0.219

No. of Spectra

1

CPC Coding Probability

0.0251476

PhyloCSF Frame 2 

0

CNTI Index

noncoding

Max Probability

0.9363

PhyloCSF Frame 3

0

CNTI Score

-0.281589662