McDonnell Genome Institute

Washington University

Transcript

lnc-TMTC4-1:1

Chromosome

chr13

Gene Name

lnc-TMTC4-1

Start

100537322

CPC Label

noncoding

End

100580117

Cancer

OV

Strand

-

Peptide

VDGATTSY

Modified Peptide

n[145]VDGATTSY

Peptide Length

8

ORF Length

45

Open Reading Frame (ORF)

LSWHLTTLFQSLCCFHRTVLTSFHFASSQPGGSLPARVDGATTSY

Conservation Score

0.023

PhyloCSF Frame 1

-3.797

No. of Spectra

1

CPC Coding Probability

0.058646

PhyloCSF Frame 2 

-3.502

CNTI Index

noncoding

Max Probability

0.5526

PhyloCSF Frame 3

-5.061

CNTI Score

-0.312403657