McDonnell Genome Institute

Washington University

Transcript

lnc-TMTC3-13:1

Chromosome

chr12

Gene Name

lnc-TMTC3-13

Start

89353342

CPC Label

noncoding

End

89373043

Cancer

OV

Strand

+

Peptide

GRPALELTPPVLHDLSQKFPPR

Modified Peptide

n[145]GRPALELTPPVLHDLSQKFPPR

Peptide Length

22

ORF Length

94

Open Reading Frame (ORF)

LPILELCFRQAAPGGACSTKVGIAELLSAPFLGSPWNKTRIFHWVSSSFSRGRPALELTPPVLHDLSQKFPPRDVSVIGTWGQGGKRQDALQRN

Conservation Score

1

PhyloCSF Frame 1

0.332

No. of Spectra

1

CPC Coding Probability

0.436484

PhyloCSF Frame 2 

-1.563

CNTI Index

coding

Max Probability

0.372

PhyloCSF Frame 3

-1.767

CNTI Score

0.675917212