McDonnell Genome Institute

Washington University

Transcript

lnc-TMTC2-2:1

Chromosome

chr12

Gene Name

lnc-TMTC2-2

Start

83151330

CPC Label

noncoding

End

83152190

Cancer

BRCA-Luminal B

Strand

+

Peptide

FLETVTNQLVVK

Modified Peptide

n[145]FLETVTNQLVVK

Peptide Length

12

ORF Length

77

Open Reading Frame (ORF)

LSLSEELAGIPDLLCIPERPCKEEELNHKSKVKKKKKEKFLETVTNQLVVKRTAVPGWLNFTKCLDIILLKMCLESC

Conservation Score

1

PhyloCSF Frame 1

0

No. of Spectra

1

CPC Coding Probability

0.0433295

PhyloCSF Frame 2 

0

CNTI Index

noncoding

Max Probability

0.3692

PhyloCSF Frame 3

0

CNTI Score

-0.309749438