McDonnell Genome Institute

Washington University

Transcript

lnc-TMSB4X-6:1

Chromosome

chrX

Gene Name

lnc-TMSB4X-6

Start

13158862

CPC Label

noncoding

End

13160904

Cancer

OV

Strand

+

Peptide

LESVGTCKGAESCVR

Modified Peptide

n[145]LESVGTCKGAESCVR

Peptide Length

15

ORF Length

36

Open Reading Frame (ORF)

LESVGTCKGAESCVRIWRRKILGWSLQSGQLYVLRM

Conservation Score

0.211

PhyloCSF Frame 1

-5.026

No. of Spectra

16

CPC Coding Probability

0.0552435

PhyloCSF Frame 2 

-4.412

CNTI Index

noncoding

Max Probability

0.5229

PhyloCSF Frame 3

-5.028

CNTI Score

-0.423914926