McDonnell Genome Institute

Washington University

Transcript

lnc-TMSB4X-1:1

Chromosome

chrX

Gene Name

lnc-TMSB4X-1

Start

13048111

CPC Label

noncoding

End

13086068

Cancer

CRC

Strand

+

Peptide

EVIPSAAVCDFFR

Modified Peptide

EVIPSAAVCDFFR

Peptide Length

13

ORF Length

55

Open Reading Frame (ORF)

LFLRLFYCPAHTLPPREVIPSAAVCDFFRKSFSLCFSQDFVLPFLLFLGLSLDGT

Conservation Score

0.808

PhyloCSF Frame 1

-4.954

No. of Spectra

1

CPC Coding Probability

0.0500754

PhyloCSF Frame 2 

-5.517

CNTI Index

noncoding

Max Probability

0.7995

PhyloCSF Frame 3

-4.768

CNTI Score

-0.459598655