McDonnell Genome Institute

Washington University

Transcript

lnc-TMSB15B-1:1

Chromosome

chrX

Gene Name

lnc-TMSB15B-1

Start

103918895

CPC Label

noncoding

End

103932911

Cancer

CCRC

Strand

+

Peptide

SHMVYVIL

Modified Peptide

n[230]SHM[147]VYVIL

Peptide Length

8

ORF Length

36

Open Reading Frame (ORF)

LQIQILLKKTVFYLYDNGTVIAEYYKMKSHMVYVIL

Conservation Score

0.981

PhyloCSF Frame 1

0

No. of Spectra

31

CPC Coding Probability

0.0367397

PhyloCSF Frame 2 

0

CNTI Index

coding

Max Probability

0.9965

PhyloCSF Frame 3

0

CNTI Score

0.669260556