McDonnell Genome Institute

Washington University

Transcript

lnc-TMSB15A-6:1

Chromosome

chrX

Gene Name

lnc-TMSB15A-6

Start

102718424

CPC Label

noncoding

End

102720663

Cancer

OV

Strand

-

Peptide

HVALSEK

Modified Peptide

n[145]HVALSEK

Peptide Length

7

ORF Length

58

Open Reading Frame (ORF)

MLVSKTNIQTPICTTRIIPVKTYGLRWEAKLPLPYYLTKLGSGGEKKHVALSEKLYQT

Conservation Score

0.96

PhyloCSF Frame 1

-5.314

No. of Spectra

11

CPC Coding Probability

0.0349559

PhyloCSF Frame 2 

-6.548

CNTI Index

noncoding

Max Probability

0.8148

PhyloCSF Frame 3

-5.796

CNTI Score

-0.344773272