McDonnell Genome Institute

Washington University

Transcript

lnc-TMSB15A-3:1

Chromosome

chrX

Gene Name

lnc-TMSB15A-3

Start

102605080

CPC Label

noncoding

End

102607319

Cancer

BRCA-Luminal B

Strand

-

Peptide

IFANHIANK

Modified Peptide

n[145]IFANHIANK

Peptide Length

9

ORF Length

41

Open Reading Frame (ORF)

LKLKTFAHQMTSSKVKKPTEQEKIFANHIANKGHVSRIYIF

Conservation Score

0.019

PhyloCSF Frame 1

-5.437

No. of Spectra

7

CPC Coding Probability

0.0200569

PhyloCSF Frame 2 

0

CNTI Index

noncoding

Max Probability

0.999

PhyloCSF Frame 3

-5.045

CNTI Score

-0.457628258