McDonnell Genome Institute

Washington University

Transcript

lnc-TMPRSS2-83:1

Chromosome

chr21

Gene Name

lnc-TMPRSS2-83

Start

41141497

CPC Label

coding

End

41237583

Cancer

BRCA-Basal-like

Strand

-

Peptide

VTGEVLTWPAESLAMP

Modified Peptide

n[145]VTGEVLTWPAESLAM[147]P

Peptide Length

16

ORF Length

128

Open Reading Frame (ORF)

LVDLTISVDSSSIRSGQAMPEVIPRASFPSWPTSSHQEVPRAPPSGSGPHRPTPHLLQGVCGGPHHCHPLLVLTGVPASFLGLLPTSSHHSPITVKSEGVSPPPPMALTSPRVTGEVLTWPAESLAMP

Conservation Score

0.208

PhyloCSF Frame 1

-4.285

No. of Spectra

16

CPC Coding Probability

0.7349

PhyloCSF Frame 2 

-3.337

CNTI Index

coding

Max Probability

0.9959

PhyloCSF Frame 3

-3.005

CNTI Score

0.687851006