McDonnell Genome Institute

Washington University

Transcript

lnc-TMPRSS15-22:1

Chromosome

chr21

Gene Name

lnc-TMPRSS15-22

Start

20576916

CPC Label

noncoding

End

20608207

Cancer

BRCA-Luminal A

Strand

-

Peptide

NIFSEVNFK

Modified Peptide

n[145]NIFSEVNFK

Peptide Length

9

ORF Length

66

Open Reading Frame (ORF)

LILYPETVLDCVCVCVLVLQHNIPSTLFQTQKQESKNIFSEVNFKKNVNGSHFAEILSINSALLRL

Conservation Score

0.356

PhyloCSF Frame 1

-5.694

No. of Spectra

69

CPC Coding Probability

0.0218563

PhyloCSF Frame 2 

-5.637

CNTI Index

noncoding

Max Probability

0.9976

PhyloCSF Frame 3

-5.753

CNTI Score

-0.516830098