McDonnell Genome Institute

Washington University

Transcript

lnc-TMPRSS15-19:3

Chromosome

chr21

Gene Name

lnc-TMPRSS15-19

Start

19664469

CPC Label

coding

End

19724973

Cancer

OV

Strand

-

Peptide

LLPLMVDGEGEPAFAK

Modified Peptide

n[145]LLPLMVDGEGEPAFAK

Peptide Length

16

ORF Length

46

Open Reading Frame (ORF)

LWCMFRRYQVGTLCGGSDPTFPGEGFKLLPLMVDGEGEPAFAKITC

Conservation Score

0.05

PhyloCSF Frame 1

0

No. of Spectra

3

CPC Coding Probability

0.932699

PhyloCSF Frame 2 

0

CNTI Index

noncoding

Max Probability

0.9332

PhyloCSF Frame 3

0

CNTI Score

-0.390026338