McDonnell Genome Institute

Washington University

Transcript

lnc-TMPRSS15-17:1

Chromosome

chr21

Gene Name

lnc-TMPRSS15-17

Start

19046309

CPC Label

noncoding

End

19047684

Cancer

LUAD

Strand

-

Peptide

INLIFAR

Modified Peptide

n[230]INLIFAR

Peptide Length

7

ORF Length

33

Open Reading Frame (ORF)

MWYESILQIQYQVDSLSGVFTPHRINLIFARQE

Conservation Score

1

PhyloCSF Frame 1

-4.685

No. of Spectra

5

CPC Coding Probability

0.0103275

PhyloCSF Frame 2 

-5.261

CNTI Index

noncoding

Max Probability

0.9945

PhyloCSF Frame 3

-4.628

CNTI Score

-0.462097214