McDonnell Genome Institute

Washington University

Transcript

lnc-TMPRSS11A-1:1

Chromosome

chr4

Gene Name

lnc-TMPRSS11A-1

Start

67991683

CPC Label

coding

End

68015768

Cancer

HCC

Strand

-

Peptide

KGDWPGK

Modified Peptide

KGDWPGK

Peptide Length

7

ORF Length

199

Open Reading Frame (ORF)

MTLGRRVSSLKPWMFALIVRAVVLILVILIGLLVYFLAYGLKFYYYQTSFQIPSIEYNPDFSVEHSKLSTDLKQKVSNEIFQRSNLNHHYIKCQVVNFRILFFRPSNDNLKADVLLKFQFIPNNENAIKTQADNILHQKLKSNESFLKTDTSLPYLRLGFFSDMNAAQAEHILNSIARKGDWPGKLACRWRGSICVVHL

Conservation Score

1

PhyloCSF Frame 1

-1.44

No. of Spectra

2

CPC Coding Probability

0.924949

PhyloCSF Frame 2 

1.306

CNTI Index

noncoding

Max Probability

0.1025

PhyloCSF Frame 3

7.68

CNTI Score

-0.365750126