McDonnell Genome Institute

Washington University

Transcript

lnc-TMPO-1:1

Chromosome

chr12

Gene Name

lnc-TMPO-1

Start

98485443

CPC Label

noncoding

End

98503936

Cancer

BRCA-Luminal A

Strand

+

Peptide

LYNERIK

Modified Peptide

n[145]LYNERIK

Peptide Length

7

ORF Length

67

Open Reading Frame (ORF)

LYNERIKKIGKVPVSSSKIVMFNSPQSCIIMKGEDISCPLPLQSPKQQPLHHILFPALPLFPNCHML

Conservation Score

0.096

PhyloCSF Frame 1

-4.568

No. of Spectra

8

CPC Coding Probability

0.0544141

PhyloCSF Frame 2 

-5.902

CNTI Index

noncoding

Max Probability

0.9993

PhyloCSF Frame 3

-5.856

CNTI Score

-0.367364433