McDonnell Genome Institute

Washington University

Transcript

lnc-TMEM8B-1:2

Chromosome

chr9

Gene Name

lnc-TMEM8B-1

Start

35858737

CPC Label

noncoding

End

35865518

Cancer

BRCA-HER2-enriched

Strand

+

Peptide

VGDTEYR

Modified Peptide

n[145]VGDTEYR

Peptide Length

7

ORF Length

43

Open Reading Frame (ORF)

LLCKVGDTEYRRGTLLGQGFNQASVFTDFFIPVPSPPLPVLSQ

Conservation Score

0.656

PhyloCSF Frame 1

-4.334

No. of Spectra

8

CPC Coding Probability

0.447245

PhyloCSF Frame 2 

-4.055

CNTI Index

noncoding

Max Probability

0.9968

PhyloCSF Frame 3

-4.558

CNTI Score

-0.319071255