McDonnell Genome Institute

Washington University

Transcript

lnc-TMEM88B-6:1

Chromosome

chr1

Gene Name

lnc-TMEM88B-6

Start

1407314

CPC Label

noncoding

End

1410420

Cancer

CCRC

Strand

+

Peptide

SCGSEGTVR

Modified Peptide

n[230]SCGSEGTVR

Peptide Length

9

ORF Length

83

Open Reading Frame (ORF)

LKGERGRSARGYSRTMDKQQRTRTVPEHGPGRSCGSEGTVRAADPGRGPRGRGARVRRGRGGAGRPLGPRGCSGTEVEMVASV

Conservation Score

0.075

PhyloCSF Frame 1

0

No. of Spectra

16

CPC Coding Probability

0.0428416

PhyloCSF Frame 2 

0

CNTI Index

coding

Max Probability

0.9995

PhyloCSF Frame 3

0

CNTI Score

0.686831463