McDonnell Genome Institute

Washington University

Transcript

lnc-TMEM86A-5:1

Chromosome

chr11

Gene Name

lnc-TMEM86A-5

Start

18588796

CPC Label

noncoding

End

18594674

Cancer

BRCA-Luminal A

Strand

+

Peptide

GVLEEFPDR

Modified Peptide

n[145]GVLEEFPDR

Peptide Length

9

ORF Length

64

Open Reading Frame (ORF)

LASRKPRPIFLEGNLGTLMKRRLGRTGVEALKEVEATRGVLEEFPDRCIKFHSVSGKSKTENCS

Conservation Score

1

PhyloCSF Frame 1

-3.345

No. of Spectra

3

CPC Coding Probability

0.164877

PhyloCSF Frame 2 

-4.13

CNTI Index

noncoding

Max Probability

0.9987

PhyloCSF Frame 3

-4.528

CNTI Score

-0.366975928